PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v3116640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family TCP
Protein Properties Length: 365aa    MW: 40968.3 Da    PI: 7.7099
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v3116640.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP151.26.7e-471112522136
              TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec.......eaesssssas....n 84 
                      ++kkdrhskihT++g+RdRRvRls+e+a++fFdLqd+LGfdk+s+t+eWL+ ++++ai el +++ s+++++          +    ++    +
  Lj1g3v3116640.1 111 PAKKDRHSKIHTSQGLRDRRVRLSIEIARKFFDLQDMLGFDKASNTLEWLFSKSNKAIEELFRSKHSDNNNStgacaadG--DGD--GDddsfS 200
                      68**************************************************************6666655544435331..211..1111212 PP

              TCP  85 sssgkaaksaakskksqksaasalnlakesrakarararertrekmriknkl 136
                      sss++ +  + k+ +++k+++ +++++kesr+karararert++km+ ++++
  Lj1g3v3116640.1 201 SSSSEDEVVSVKRAQKEKEPSGVQAKMKESREKARARARERTSNKMCPETEN 252
                      22235555556899999999999************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.6E-41112247IPR005333Transcription factor, TCP
PROSITE profilePS5136934.783113171IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137011.607228245IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MFPNSSYPYP YFPSSSSSSP SPYPPFNFLN PGNASTNNIF LHDPPPLPSV PYTNNTTNTH  60
HHHAPPTCSE TFTNWALADA MLKQENLTGG PHHHYNLSNF LTRKLPAAKK PAKKDRHSKI  120
HTSQGLRDRR VRLSIEIARK FFDLQDMLGF DKASNTLEWL FSKSNKAIEE LFRSKHSDNN  180
NSTGACAADG DGDGDDDSFS SSSSEDEVVS VKRAQKEKEP SGVQAKMKES REKARARARE  240
RTSNKMCPET ENPQMQLHQF SSEFQPHQEL HRDDDFKVFE ESIVIKRKLK QSLMSSSHHH  300
QNQNIGIPKE ASFNNNNNSE CPSSFPMSPN WDASGATPRS NICAIASVNL STGLQIFGKS  360
WEECT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00215DAPTransfer from AT1G67260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2024750.0DQ202475.1 Lotus corniculatus var. japonicus CYC1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007151756.11e-101hypothetical protein PHAVU_004G072100g
TrEMBLQ1WK580.0Q1WK58_LOTJA; CYC1
STRINGGLYMA08G28691.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17383294
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.21e-26TCP family protein
Publications ? help Back to Top
  1. Feng X, et al.
    Control of petal shape and floral zygomorphy in Lotus japonicus.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(13): p. 4970-5
    [PMID:16549774]